KEGG   Escherichia coli O9 HS (commensal): EcHS_A0248
Entry
EcHS_A0248        CDS       T00591                                 

Definition
(GenBank) Inhibitor of vertebrate lysozyme
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Ivy Sld7_N
Other DBs
NCBI-ProteinID: ABV04638
Structure
PDB: 
1XS0 1GPQ

Position
269901..270374
AA seq 157 aa
MGRISSGGMMFKAITTVAALVIATSAMAQDDLTISSLAKGETTKAAFNQMVQGHKLPAWV
MKGGTYTPAQTVTLGDETYQVMSACKPHDCGSQRIAVMWSEKSNQMTGLFSTIDEKTSQE
KLTWLNVNDALSIDGKTVLFAALTGSLENHPDGFNFK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgggcaggataagctcgggaggaatgatgtttaaggcaataacgacagtcgccgctctg
gtcatcgccaccagtgcaatggcgcaggatgatttaaccattagcagccttgcaaagggc
gaaaccaccaaagctgcatttaatcagatggtacaagggcataagctgcctgcctgggtg
atgaaaggcggtacttatactcccgcacaaaccgtaacgttgggagatgagacgtatcag
gtgatgagcgcgtgcaaaccgcatgactgtggctcgcaacgtatcgctgtgatgtggtcc
gagaaatctaatcagatgacggggctgttctcgactattgatgagaaaacgtcgcaagag
aaactcacctggctgaatgtgaacgatgcgctttcgattgatggtaaaacggtgctgttc
gcggcgttgaccggcagcctggaaaaccatccggatggctttaattttaaataa

DBGET integrated database retrieval system