KEGG   Escherichia coli O9 HS (commensal): EcHS_A0249
Entry
EcHS_A0249        CDS       T00591                                 

Gene name
fadE
Definition
(GenBank) acyl-coenzyme A dehydrogenase
  KO
K06445  acyl-CoA dehydrogenase [EC:1.3.99.-]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00071  Fatty acid degradation
ecx01100  Metabolic pathways
ecx01212  Fatty acid metabolism
Module
ecx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EcHS_A0249 (fadE)
Enzymes [BR:ecx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-  
     EcHS_A0249 (fadE)
SSDB
Motif
Pfam: DUF1974 Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M
Other DBs
NCBI-ProteinID: ABV04639
Position
complement(270417..272861)
AA seq 814 aa
MMILSILATVVLLGALFYHRVSLFISSLILLAWTAALGVAGLWSAWVLVPLAIILVPFNF
APMRKSMISAPVFRGFRKVMPPMSRTEKEAIDAGTTWWEGDLFQGKPDWKKLHNYPQPRL
TAEEQAFLDGPVEEACRMANDFQITHELADLPPELWAYLKEHRFFAMIIKKEYGGLEFSA
YAQSRVLQKLSGVSGILAITVGVPNSLGPGELLQHYGTDEQKDHYLPRLARGQEIPCFAL
TSPEAGSDAGAIPDTGIVCMGEWQGQQVLGMRLTWNKRYITLAPIATVLGLAFKLSDPEK
LLGGAEDLGITCALIPTTTPGVEIGRRHFPLNVPFQNGPTRGKDVFVPIDYIIGGPKMAG
QGWRMLVECLSVGRGITLPSNSTGGVKSVALATGAYAHIRRQFKISIGKMEGIEEPLARI
AGNAYVMDAAASLITYGIMLGEKPAVLSAIVKYHCTHRGQQSIIDAMDITGGKGIMLGQS
NFLARAYQGAPIAITVEGANILTRSMMIFGQGAIRCHPYVLEEMEAAKNNDVNAFDKLLF
KHIGHVGSNKVRSFWLGLTRGLTSSTPTGDATKRYYQHLNRLSANLALLSDVSMAVLGGS
LKRRERISARLGDILSQLYLASAVLKRYDDEGRNEADLPLVHWGVQDALYQAEQAMDDLL
QNFPNRVVAGLLNVVIFPTGRHYLAPSDKLDHKVAKILQVPNATRSRIGRGQYLTPSEHN
PVGLLEEALVDVIAADPIHQRICKELGKNLPFTRLDELAHNALAKGLIDKDEAAILVKAE
ESRLRSINVDDFDPEELATKPVKLPEKVRKVEAA
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgatgattttgagtattctcgctacggttgtcctgctcggcgcgttgttctatcaccgc
gtgagcttatttatcagcagtctgattttgctcgcctggacagccgccctcggcgttgct
ggtctgtggtcggcgtgggtactggtgcctctggccattatcctcgtgccatttaacttt
gcgcctatgcgtaagtcgatgatttccgcgccggtatttcgcggtttccgtaaggtgatg
ccgccgatgtcgcgcactgagaaagaagcgattgatgcgggcaccacctggtgggagggc
gacttgttccagggcaagccggactggaaaaagctgcataactatccgcagccgcgcctg
accgccgaagagcaagcgtttctcgacggcccggtagaagaagcctgccggatggcgaat
gatttccagatcacccatgagctggcggatctgccgccggagttgtgggcgtaccttaaa
gagcatcgtttcttcgcgatgatcatcaaaaaagagtacggcgggctggagttctcggct
tatgcccagtctcgcgtgctgcaaaaactctccggcgtgagcgggatcctggcgattacc
gtcggcgtgccaaactcattaggcccgggcgaactgttgcaacattacggcactgacgag
cagaaagatcactatctgccgcgtctggcgcgtggtcaggagatcccctgctttgcactg
accagcccggaagcgggttccgatgcgggcgcgattccggacaccgggattgtctgcatg
ggcgaatggcagggccagcaggtgctggggatgcgtctgacctggaacaaacgctacatt
acgctggcaccgattgcgactgtgcttgggctggcgtttaaactctccgacccggaaaag
ctgctgggtggcgcagaagatttaggtattacctgtgcgctgatcccgaccaccacgccg
ggcgtggaaattggtcgtcgccacttcccgctgaacgtaccgttccagaacggaccgacg
cgcggtaaagatgtcttcgtaccgatcgattacatcatcggtgggccgaaaatggccggg
caaggctggcggatgctggtggagtgcctctcggtaggccgcggcatcaccctgccttcc
aactcaaccggcggcgtgaaatcggtagcgctggcaacgggcgcgtatgctcacattcgc
cgtcagttcaaaatctctatcggtaagatggaagggattgaagagccgctggcgcgtatt
gccggtaatgcctacgtgatggatgctgcggcatcgctgattacctacggcattatgctc
ggcgaaaaacctgccgtgctgtcggctatcgttaagtatcactgtacccaccgcgggcag
cagtcgattattgatgcgatggatatcactggtggcaaaggcattatgctcgggcagagc
aacttcctggcgcgtgcttaccagggcgcaccgattgccatcaccgttgaaggggccaac
attctgacccgcagcatgatgatcttcggacaaggagcgattcgttgccatccgtacgtg
ctggaagagatggaagcagcgaagaacaatgacgtcaacgcgttcgataaactgttgttc
aaacatatcggtcacgtcggtagcaacaaagttcgcagcttctggctgggcctgacgcgc
ggtttaaccagcagcacgccaaccggcgatgccactaaacgctactatcagcacctgaac
cgcctgagcgccaacctcgccctgctttctgatgtctcgatggctgtgctgggcggcagc
ctgaaacgtcgtgagcgcatctcggcacgtctgggggatattttaagccagctttacctc
gcctctgccgttctgaagcgttatgacgacgaaggccgtaatgaagccgacctgccgctg
gtgcactggggcgtacaagatgcgctgtatcaggctgaacaggcgatggatgatttactg
caaaacttcccgaaccgcgtggttgccgggctgctgaatgtggtgatcttcccgaccgga
cgtcattatctggcaccttctgacaagctggatcataaagtggcgaagattttacaagtg
ccgaacgccacccgttcccgcattggtcgcggtcagtacctgacgccgagcgagcataat
ccggttggcttgctggaagaggcgctggtggatgtgattgccgccgacccaattcatcag
cggatctgtaaagagctgggtaaaaacctgccgtttacccgtctggatgaactggcgcac
aacgcgctggcgaaggggctgattgataaagatgaagccgctattctggtgaaagctgaa
gaaagccgtctgcgcagtattaacgttgatgactttgatccggaagagctggcgacgaag
ccggtaaagttgccggagaaagtgcggaaagttgaagccgcgtaa

DBGET integrated database retrieval system