KEGG   Escherichia coli O9 HS (commensal): EcHS_A0250
Entry
EcHS_A0250        CDS       T00591                                 

Gene name
gmhA
Definition
(GenBank) phosphoheptose isomerase
  KO
K03271  D-sedoheptulose 7-phosphate isomerase [EC:5.3.1.28]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00540  Lipopolysaccharide biosynthesis
ecx01100  Metabolic pathways
Module
ecx_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    EcHS_A0250 (gmhA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ecx01005]
    EcHS_A0250 (gmhA)
Enzymes [BR:ecx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.28  D-sedoheptulose 7-phosphate isomerase
     EcHS_A0250 (gmhA)
Lipopolysaccharide biosynthesis proteins [BR:ecx01005]
 Unusual sugar
  EcHS_A0250 (gmhA)
SSDB
Motif
Pfam: SIS_2 SIS Antibiotic_NAT
Other DBs
NCBI-ProteinID: ABV04640
UniProt: A7ZWI6
Structure
PDB: 
2I2W 2I22

Position
273101..273679
AA seq 192 aa
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFNDIFSRYVEAVGREGDVLLGIST
SGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFGYADRIQEIHIKVIH
ILIQLIEKEMVK
NT seq 579 nt   +upstreamnt  +downstreamnt
atgtaccaggatcttattcgtaacgaactgaacgaagcggcggaaacgctggctaacttt
ttaaaagatgacgccaatattcacgccattcagcgcgcggcggtcctgttagcagacagc
tttaaagccggtggcaaagtgctttcctgcggcaacggcggttcccattgcgacgctatg
cactttgccgaagagttgaccggtcgctaccgtgaaaaccgtccgggctacccggcgatt
gctatttctgacgttagtcatatttcctgcgtcggtaatgatttcggtttcaatgatatt
ttctcccgctacgttgaagcggtaggtcgcgaaggcgatgtactgctggggatctccacc
tccggtaactctgcaaacgtgatcaaagcgatcgcagcggcgcgtgagaaggggatgaaa
gtgatcaccctgaccggtaaagacggcggcaaaatggctggcacggcggatatcgaaatt
cgcgtaccgcactttggttatgccgaccgcattcaggagattcacattaaagtgatccat
atcctgatccagttgattgaaaaagagatggttaagtaa

DBGET integrated database retrieval system