KEGG   Escherichia coli O9 HS (commensal): EcHS_A0251
Entry
EcHS_A0251        CDS       T00591                                 

Definition
(GenBank) glutamine amidotransferase, class II
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: GATase_4 GATase_6
Other DBs
NCBI-ProteinID: ABV04641
Position
273885..274652
AA seq 255 aa
MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKGCRTFKDPQPSFNSPI
AKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWTYAHNGQLTGYKSLETG
NFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMAAVFKYIASLADELRQKGVFNMLLSDGR
YVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDVVTVIATQPLTGNETWQKI
MPGEWRLFCLGERVV
NT seq 768 nt   +upstreamnt  +downstreamnt
atgtgcgaattgctcgggatgagcgccaacgtccctaccgatatctgctttagtttcacc
gggcttgtacagcgtggtggtggaaccgggccacataaagatggctggggcattaccttt
tacgaaggtaaaggctgtcgcacatttaaagatccacaacccagctttaattcccccatc
gccaaacttgtccaggactacccgataaaatcctgttcggtggtggctcatattcgccag
gctaatcggggcgaggtggcgctggaaaatactcacccatttacccgcgagttatggggg
cgtaactggacttatgcccataacggacaactgacgggctacaaatcactggaaaccggc
aacttccgcccggtaggcgaaaccgacagcgaaaaagccttttgctggctcctgcataaa
ttaacgcagcgttacccgcgcacaccgggcaacatggcggcggtatttaaatatatcgcc
tcactggcggatgaactgcggcagaagggcgttttcaacatgctgctttctgacgggcgc
tatgtaatggcgtattgctcgactaatttacactggatcacccgccgcgcgccgtttggc
gtggcaacgttgctggatcaggatgtggaaatcgacttcagctcgcagaccacaccgaat
gatgtggtcacggtgattgcgacacagccgctgacgggcaatgaaacctggcaaaaaatt
atgccaggcgaatggcgcttattttgcctcggggagcgtgtagtttga

DBGET integrated database retrieval system