KEGG   Escherichia coli O9 HS (commensal): EcHS_A0252
Entry
EcHS_A0252        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: YkuD
Other DBs
NCBI-ProteinID: ABV04642
Position
complement(274623..275363)
AA seq 246 aa
MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVYIQIFKEERTLDLYVK
MGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLKPDSRYYKAINIGFPNA
YDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALVFGQPSVQVSIYPFRMTD
ANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYVVSKPLSHEVVQPQLASNY
TLPEAK
NT seq 741 nt   +upstreamnt  +downstreamnt
atgcgtaaaatcgcattaattcttgcgatgttgttgatcccgtgcgtttcgtttgccggt
ttgctgggcagcagtagctcgaccacgccagtgagcaaagagtataagcagcagttgatg
ggatcccctgtctacatccagatcttcaaggaagaacgtacgctcgatctctacgtcaaa
atgggcgagcaatatcagctgctcgacagttataaaatctgtaaatattccggcggctta
gggccaaaacagcgtcagggcgatttcaaaagcccggaagggttttatagcgtccagcgt
aatcagttaaaaccagacagccgttactacaaagcgattaatattggtttccccaatgcc
tatgaccgtgcgcatggttatgaagggaaatacctgatgatccacggcgattgtgtttcc
atcggctgctacgcgatgaccaatcagggcattgacgagattttccagttcgttactggc
gcactggtatttggtcagccgagcgtgcaagtgagcatttacccgttccgcatgaccgac
gctaatatgaagcgccacaaatattccaactttaaggacttctgggagcaactgaagccg
ggttacgactactttgagcaaacccgtaagccaccgaccgtttctgtggtcaatggtcgt
tacgtggtcagcaagccgttaagccacgaagttgtgcaaccacagctggcatcaaactac
acgctccccgaggcaaaataa

DBGET integrated database retrieval system