KEGG   Escherichia coli O9 HS (commensal): EcHS_A0253
Entry
EcHS_A0253        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein TIGR00053
  KO
K19157  mRNA interferase YafQ [EC:3.1.-.-]
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ecx02048]
    EcHS_A0253
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     EcHS_A0253
Prokaryotic defense system [BR:ecx02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YafQ-dinJ
    EcHS_A0253
SSDB
Motif
Pfam: YafQ_toxin
Other DBs
NCBI-ProteinID: ABV04643
Structure
PDB: 
4MMG 4ML2 4Q2U 4MMJ 4ML0

Position
complement(275519..275797)
AA seq 92 aa
MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPAVYKDHPLQGSWKGYR
DAHVEPDWILIYKLTDKLLRFERTGTHAALFG
NT seq 279 nt   +upstreamnt  +downstreamnt
atgattcaaagggatattgaatactcgggacaattttcaaaggatgtaaaacttgcacaa
aagcgtcataaggatatgaataaattgaaatatcttatgacgcttcttatcaataatgct
ttaccgcttccagctgtttataaagaccacccgctgcaaggttcatggaaaggttatcgc
gatgctcatgtcgaaccggactggatcctgatttacaaacttaccgataaacttttacga
tttgagagaactggaactcacgcggcgctctttgggtaa

DBGET integrated database retrieval system