KEGG   Escherichia coli O9 HS (commensal): EcHS_A0254
Entry
EcHS_A0254        CDS       T00591                                 

Definition
(GenBank) addiction module antitoxin, RelB/DinJ family
  KO
K07473  DNA-damage-inducible protein J
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ecx02048]
    EcHS_A0254
Prokaryotic defense system [BR:ecx02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YafQ-dinJ
    EcHS_A0254
SSDB
Motif
Pfam: RelB
Other DBs
NCBI-ProteinID: ABV04644
Structure
PDB: 
4Q2U 4ML0

Position
complement(275800..276060)
AA seq 86 aa
MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFDLREPNQLTIQ
SIKNSEAGVDVHKAKDADDLFDKLGI
NT seq 261 nt   +upstreamnt  +downstreamnt
atggctgctaacgcatttgttcgcgcccgaatcgatgaagatctgaagaatcaggcggcg
gacgtactggccgggatggggctgaccatctctgacctggttcgcataaccctcacaaag
gtcgcgcgtgaaaaggcattgccgtttgatttacgcgagcctaatcaattaaccattcaa
tcaatcaaaaacagcgaagctggcgttgatgttcataaggccaaagacgccgatgattta
tttgataaattaggaatttaa

DBGET integrated database retrieval system