KEGG   Escherichia coli O9 HS (commensal): EcHS_A0255
Entry
EcHS_A0255        CDS       T00591                                 

Definition
(GenBank) NlpC/P60 family protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: NLPC_P60 DUF1175 Peptidase_C92 LRAT
Other DBs
NCBI-ProteinID: ABV04645
Position
276210..277019
AA seq 269 aa
MFRYGPGYTATSMHDQPLLSMSLPSIPSFVLSGLLLLCLPFSSFASATTSHITFSYAARQ
RMQNRARLLKQYQTHLKKQASYIVEGNAESRRALRQHNREQIKQHPEWFPAPLKASDRRW
QALAENNHFLSSDHLHNITEVAIHRLEQQLGKPYVWGGTRPDQGFDCSGLVFYAYNKILE
AKLPRTANEMYHYRRATIVANNDLRRGDLLFFHIHSREIADHMGVYLGDGQFIESPRTGE
TIRVSQLAEPFWQDHFLGARRILTEETIL
NT seq 810 nt   +upstreamnt  +downstreamnt
ttgttcaggtacgggccgggatacactgcaacatcaatgcatgatcagccattattgagt
atgtccttgccgtcgattccctcttttgtgttgtcgggattactgttgctttgcttgccg
ttttcttcatttgccagcgccaccacatcacatatcactttcagctacgccgcccgccag
cggatgcaaaatcgtgcgcgtttattaaaacagtaccaaacccatctgaaaaaacaggcc
agctatattgtggaaggcaatgccgaaagcagaagggcgctacgccagcacaaccgcgaa
cagataaaacagcatccagaatggtttcctgcgccgctcaaggcgagtgacagacgctgg
caggcgctggcggaaaacaaccatttcttaagcagcgaccatctgcataacatcaccgaa
gtggcgattcaccgtctggagcaacagcttggcaagccttacgtctggggcggtacgcgg
cccgatcaaggcttcgactgtagcgggttagttttttatgcctacaacaagatccttgag
gcgaaactcccacgcacggctaatgagatgtatcactatcgccgggcaaccattgtggcg
aataacgacctgcgccggggagatttgctatttttccatatccacagccgcgagattgcc
gaccatatgggggtgtatctgggcgacggtcagtttattgagtcaccgcgcaccggggaa
accattcgggtaagtcagttagctgaacctttctggcaggatcactttttaggcgcgcgg
cggattttgacggaggagacgattttgtaa

DBGET integrated database retrieval system