KEGG   Escherichia coli O9 HS (commensal): EcHS_A0257
Entry
EcHS_A0257        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: HicA_toxin
Other DBs
NCBI-ProteinID: ABV04647
Position
complement(277425..277703)
AA seq 92 aa
MIKVSALGSRHRKTFDDVMTEPPKSGIKWDDVVALIKAVGGTIKNNNGSRRKFQIGTTKF
STHEPHPKNVMDKGAVAGLKEWFVNCVGVDYE
NT seq 279 nt   +upstreamnt  +downstreamnt
atgattaaggtcagcgcgctaggttctcgtcatagaaaaacattcgacgatgtaatgacg
gagccgccaaaatctggaattaaatgggatgatgttgttgcactcattaaagctgtgggt
ggaacaataaaaaataacaacggctccagacgaaaatttcagattggaacgaccaaattc
agcacacatgagccacatccaaaaaatgtgatggataaaggcgcagtagcaggtcttaag
gagtggtttgttaactgtgtaggggtagattatgaataa

DBGET integrated database retrieval system