KEGG   Escherichia coli O9 HS (commensal): EcHS_A0258
Entry
EcHS_A0258        CDS       T00591                                 

Definition
(GenBank) putative chemotaxis protein
  KO
K02557  chemotaxis protein MotB
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx02030  Bacterial chemotaxis
ecx02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    EcHS_A0258
   02040 Flagellar assembly
    EcHS_A0258
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecx02000]
    EcHS_A0258
   02035 Bacterial motility proteins [BR:ecx02035]
    EcHS_A0258
Transporters [BR:ecx02000]
 Other transporters
  Pores ion channels [TC:1]
   EcHS_A0258
Bacterial motility proteins [BR:ecx02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    EcHS_A0258
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: ABV04649
Position
279507..280277
AA seq 256 aa
MIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHPPKPATVAVPEETEKKARDVN
EKTALLKKKSATELGELATSITTIARDAHMEANLEMEIVPQGLRVLIKDDQNRNMFERGS
AQIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKNNIYNNWNLSGDRALSARRVLEE
AGMPEDKVMQVSAMADQMLLDSKNPQSAGNRRIEIMVLTKSASDTLYQYFGQHGDKVVQP
LVQKLDKQQVLSQRTR
NT seq 771 nt   +upstreamnt  +downstreamnt
ttgattgtcaacagcgtcagtaaatccgagcgtgaaagcattatcgccgcgctgcacggg
cagtcgatttttaacggtggtgggctgtcgccgttaaataaaatcagcccgtctcatccg
ccaaaacctgccaccgtggcggtgccggaagaaacggagaaaaaagcgcgcgacgtcaat
gagaaaacggcgctgctgaagaagaaatccgccaccgagcttggcgagctggcaaccagt
atcaccaccattgcccgtgatgcgcatatggaagcgaatctggagatggagattgttccc
cagggattacgcgtgctgattaaagacgaccagaatcgcaatatgttcgaacgcggcagc
gcgcagattatgccgttctttaaaacgctgctggtggagctcgcgccagttttcgactcg
ctcgataacaaaattattattaccgggcataccgatgcgatggcttacaaaaacaatatc
tacaacaactggaacctttcgggtgaccgcgcgctttcggctcgtcgggtgctggaagag
gccggaatgccggaagataaagtgatgcaggtaagcgcaatggcggaccagatgctgctg
gattccaaaaatccgcaaagcgcgggcaaccggcgcattgagattatggtgctgaccaaa
agtgcgtccgatacgctgtatcaatactttggtcagcatggggataaagtggtgcagccg
ctggtgcaaaagctggataagcagcaggtgctttcgcagcgaacgcgttaa

DBGET integrated database retrieval system