KEGG   Escherichia coli O9 HS (commensal): EcHS_A0259
Entry
EcHS_A0259        CDS       T00591                                 

Definition
(GenBank) type III secretion protein, FHIPEP family
  KO
K02400  flagellar biosynthesis protein FlhA
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    EcHS_A0259
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecx02044]
    EcHS_A0259
   02035 Bacterial motility proteins [BR:ecx02035]
    EcHS_A0259
Secretion system [BR:ecx02044]
 Type III secretion system
  Flagellar export apparatus
   EcHS_A0259
Bacterial motility proteins [BR:ecx02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    EcHS_A0259
SSDB
Motif
Pfam: FHIPEP
Other DBs
NCBI-ProteinID: ABV04648
Position
complement(277808..279547)
AA seq 579 aa
MLSRSDLLTLLTINFIVVTKGAERISEVSARFTLDAMPGKQMAIDADLNAGLINQAQAQT
RRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVYIGIFKYNLSADAAFQQYV
LMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRNQLLASPSVLYTATGIMFVLA
VVPGMPHLPFLLFSALLGFTGWRMSKRPQAAEAEEKSLETLTRTITETSEQQVSWETIPL
IEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGVLLPEIRIRENFRLKPSQYA
IFINGIKADEADIPADKLMALPSSETYGEIDGVLGNDPAYGMPVTWIQPAQKAKALNMGY
QVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLASMAPRLAEDLSAVLNYSQLLKV
YRALLTEGVSLRDIVTIATVLVASSAVTKDHILLAADVRLALRRSITHPFVRKQELTVYT
LNNELENLLTNLVNQAQQGGKVMLDSVPVDPNMLNQFQSTMPQVKEQMKTAGKDPVLLVP
PQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMGALS
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgctttcacgctcggatttactgacgctgttgacaatcaactttattgtcgtcaccaaa
ggggccgagcgtatctccgaggtttctgcccgctttaccctggacgcgatgcccggtaag
cagatggcgattgacgccgatcttaatgccgggttgatcaatcaggcgcaggcacaaacc
cgacgtaaagatgttgccagcgaggccgatttctacggcgcgatggacggggcatcgaaa
tttgtgcgcggggatgctatcgccgggatgatgattctggcgatcaacctgatcggcggc
gtctatatcgggatcttcaaatacaacctgagcgccgacgccgccttccagcagtatgtg
ctgatgaccatcggcgacgggctggtggcgcaaatcccttccctgctactctccaccgcg
gcggcgattatcgtcacccgcgtcagcgacaacggcgatatcgcccatgacgtgcgtaac
cagttgctggcaagcccatcggtgctctacaccgctaccggaattatgttcgtactggcg
gtagtgccgggaatgccacatctgccgtttttgctgttcagcgccctgcttggctttacc
ggctggcggatgagcaaacgcccgcaggcggcggaagcggaagagaaaagtctcgaaacg
ctgacccgcaccatcaccgaaaccagcgagcaacaggtcagttgggaaaccattccgctg
atcgagcccatcagcttaagcctcggctacaagctggtggcgctggtggacaaagcccag
ggcaacccgctcacccagcgtattcgcggcgtgcgacaggtgatatccgacggcaacggc
gtgctgctgccggagatccgcattcgggaaaacttccgccttaagcccagccagtacgct
attttcatcaacggcattaaggctgatgaagcggatattccggcggataaactgatggcg
ctgccctccagcgaaacctacggcgagatagacggcgtgctggggaacgacccggcgtac
gggatgccggtgacctggatccagcctgcgcagaaagcgaaggcgctgaatatggggtat
caggtgatcgacagcgccagcgtgattgctacccatgtaaataagattgtgcgcagctat
attcctgatttatttaactatgacgatattacgcagttgcataaccgtttggcgtcgatg
gcaccgcgcctggcggaggatttaagcgcggtgctcaattacagccagttgctgaaagtg
taccgggcgctgctgaccgaaggcgtttccctgcgcgatatcgtcaccatcgccaccgtg
ctggtcgccagtagcgcggtgaccaaagatcatattctgctggcagccgatgtgcgcctg
gcgctgcggcgcagcattacccatccgttcgttcgcaagcaggagctgacggtgtatacc
ctgaataatgagctggaaaatctgctgactaacctagtgaatcaggcgcaacagggcggt
aaagtgatgctcgacagcgtgccagtggacccgaatatgctcaaccagttccagagtacg
atgccacaggtgaaagagcagatgaaaacggcggggaaagacccggtgctgctggtgcca
ccgcagctgcgccctttgctggcgcgttatgcaaggttgtttgcgccggggctgcatgtg
ctgtcgtataacgaagtgccggatgagctggagttgaagattatgggggcgttgagttga

DBGET integrated database retrieval system