KEGG   Escherichia coli O9 HS (commensal): EcHS_A0261
Entry
EcHS_A0261        CDS       T00591                                 

Definition
(GenBank) acetyltransferase, GNAT family
  KO
K03830  putative acetyltransferase [EC:2.3.1.-]
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EcHS_A0261
Enzymes [BR:ecx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     EcHS_A0261
SSDB
Motif
Pfam: Acetyltransf_10 Acetyltransf_7 Acetyltransf_1 Acetyltransf_9 FR47
Other DBs
NCBI-ProteinID: ABV04651
Position
281400..281852
AA seq 150 aa
MNNIQIRDYQPGDFQQLCAIFIRAVTMTASQHYSPQQIAAWAQIDESRWKEKLAKSQVRV
AVINAKLVGFITCVEHYIDMLFVDPEYTRRGVASALLKPLIKSESELTVDASITAKPFFE
RYGFQTVKQQRVECRGEWFINFYMRYKQQH
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaataacatacaaataagagactatcagcctggcgattttcagcaactatgcgctatt
ttcattagagcggttacgatgactgccagtcagcattattcaccacaacaaattgccgcc
tgggcgcagattgacgaatctcgctggaaggagaaactcgcgaaatcacaagtgcgggtt
gcagtcattaatgcaaaactggtcggctttattacctgcgttgaacactatatcgatatg
ttatttgttgaccctgaatacacccgccgtggggttgccagcgctttgttaaaacctttg
attaagtctgaatccgaacttacggtggacgcaagcataaccgcaaaacccttttttgaa
cgttatggttttcagacagttaagcagcaacgcgttgaatgtcggggagagtggtttatt
aatttttatatgcgttataaacagcaacattaa

DBGET integrated database retrieval system