KEGG   Escherichia coli O9 HS (commensal): EcHS_A0262
Entry
EcHS_A0262        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K18148  release factor H-coupled RctB family protein
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EcHS_A0262
SSDB
Motif
Pfam: RtcB
Other DBs
NCBI-ProteinID: ABV04652
Position
282071..283237
AA seq 388 aa
MTSLFTEWYMGNYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQRVVGMPDLHPG
RGYPIGAAFFSVGRFYPALVGNDIGCGMALWQTDILTRKYNADKFEKRLSDLDDVAEESW
LEENLPSAFAQHPWRSSLGSIGGGNHFAELQQVDQIINAELFALAGLDAQHLQLLVHSGS
RGVGQSILQRHIASFSHHGLPQGSDDALRYIAEHDDALAFACINRQMIALRIMQQVKATG
SPVLDVAHNFVSACQIGDQQGWLHRKGATPDDNGLVIIPGSRGDYSWIVQPVANEKTLHS
LAHGAGRKWGRTECKGRLAAKYTVTQLSRTELGSRVICRDKQLIFEEAPQAYKSAESVVQ
CLVQAGLIIPVARLRPVLTLKNSGGKKG
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgacgagtctatttacggaatggtatatgggcaattatattcgtcccttatccgatgcg
gtatttaccatcgcatctgatgacctgtggatcgagagtttagcgatccaacaattacac
accacggcaaatttacccaacatgcagcgcgtagtggggatgccagatttacatcccgga
cgcggctatccgattggcgcagcgttcttctctgttggtcgtttttatccggcactggtc
ggcaatgatatcggctgcggtatggcgctatggcaaacagatattctcactcgcaaatac
aacgccgataagtttgaaaagcgattatcagatctggatgacgttgctgaagaaagctgg
ctggaggaaaacctgccgtcagcatttgcacagcatccgtggcgcagctcgcttggctct
atcggtggcggcaatcatttcgctgaactgcaacaagttgatcaaatcatcaacgctgaa
ctgtttgcactggcaggtctggatgcacaacatctgcaactgttggttcatagcggctcg
cggggggtggggcagtctattttacagcggcatattgcctcgttctcgcatcatggtttg
cctcaaggcagtgacgacgcgctacggtatattgcggaacatgacgatgcgctggcgttt
gcgtgtattaatcgccagatgatcgctttgcgcataatgcaacaagttaaggccacggga
agtccggttctggatgtggcgcataactttgttagcgcgtgtcaaatcggcgatcaacag
ggctggttgcatcgtaaaggtgccacgccggatgacaacggtctggtgattattcccggt
tcacgtggtgattactcctggattgtacagcctgttgcgaacgaaaaaacgctccactcg
ctggcgcatggggcagggcgtaaatgggggcgcaccgagtgtaaagggcgtctggcagcg
aaatacacggtgacgcaactctcgcggactgaacttggcagtcgggtaatttgtcgcgat
aaacaactcatctttgaagaagcgccacaagcctataaatcggctgaaagcgtggtgcaa
tgtctggtgcaggccggtttaattattcctgtcgcgcggctgcgtccggtgctaacgctc
aaaaacagtggagggaaaaaaggatga

DBGET integrated database retrieval system