KEGG   Escherichia coli O9 HS (commensal): EcHS_A0263
Entry
EcHS_A0263        CDS       T00591                                 

Definition
(GenBank) peptidyl-tRNA hydrolase domain protein
  KO
K02839  peptide chain release factor
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ecx03012]
    EcHS_A0263
Translation factors [BR:ecx03012]
 Prokaryotic type
  Release factors
   EcHS_A0263
SSDB
Motif
Pfam: RF-1
Other DBs
NCBI-ProteinID: ABV04653
Position
283234..283848
AA seq 204 aa
MILLQLSSAQGPEECCLAVKKALERLIKEAARQDVAVTVLETETGRYSDTLRSALVSLDG
DNAWALSESWCGTIQWICPSPYRPHHGRKNWFLGIGRFTADEQEQSDAIRYETLRSSGPG
GQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLLIAWKLEQQQQENSAVLKSQR
RMFHHQIERGNPRRTFTGMAFIEG
NT seq 615 nt   +upstreamnt  +downstreamnt
atgatcttgctacaactctcctcagcgcaggggccggaagaatgttgtctcgcagtgaaa
aaggcgctggagcgattaattaaagaagctgcccgacaagacgtcgcggtaacggtgttg
gaaacagaaacgggccgctactctgacacgctgcgttcagctctggtttctctggatggc
gataacgcatgggcattaagcgaaagctggtgcggcactattcagtggatttgtccgagt
ccgtatcggcctcatcatgggcgcaaaaactggtttctgggcattgggcgttttaccgct
gatgagcaggaacaatcggatgcaatccgttatgagacgttgcgttcgtcggggccgggc
ggtcaacatgtcaataaaaccgactcggcggtacgcgccacgcatttggcatccggtatt
agcgtgaaggttcagtcagagcgtagtcagcatgctaacaagcggctggcacgattgctg
attgcctggaagctggagcagcagcaacaggaaaatagcgcggtgctgaaatcgcagcgg
cgaatgttccatcaccagattgaacgtggcaacccgagacggacatttacagggatggct
tttatcgaaggataa

DBGET integrated database retrieval system