KEGG   Escherichia coli O9 HS (commensal): EcHS_A0264
Entry
EcHS_A0264        CDS       T00591                                 

Gene name
pepD
Definition
(GenBank) aminoacyl-histidine dipeptidase
  KO
K01270  dipeptidase D [EC:3.4.13.-]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00480  Glutathione metabolism
ecx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EcHS_A0264 (pepD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecx01002]
    EcHS_A0264 (pepD)
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.-  
     EcHS_A0264 (pepD)
Peptidases and inhibitors [BR:ecx01002]
 Metallo peptidases
  Family M20
   EcHS_A0264 (pepD)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Other DBs
NCBI-ProteinID: ABV04654
Position
complement(283905..285362)
AA seq 485 aa
MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEYIVGWAKEKGFHVERDQVGNILIRKP
ATAGMENRKPVVLQAHLDMVPQKNNDTVHDFTKDPIQPYIDGEWVKARGTTLGADNGIGM
ASALAVLADENVVHGPLEVLLTMTEEAGMDGAFGLQSNWLQADILINTDSEEEGEIYMGC
AGGIDFTSNLHLDREAVPAGFETFKLTLKGLKGGHSGGEIHVGLGNANKLLVRFLAGHAE
ELDLRLIDFNGGTLRNAIPREAFATIAVAADKVDVLKSLVNTYQEILKNELAEKEKNLAL
LLDSVANDKAALIAKSRDTFIRLLNATPNGVIRNSDVAKGVVETSLNVGVVTMTDNNVEI
HCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGAYPGWQPDANSPVMHLVRETYQRLFN
KTPNIQIIHAGLECGLFKKPYPEMDMVSIGPTITGPHSPDEQVHIESVGHYWTLLTELLK
EIPAK
NT seq 1458 nt   +upstreamnt  +downstreamnt
gtgtctgaactgtctcaattatctccacagccgctgtgggatatttttgccaaaatctgt
tctattcctcacccgtcctatcatgaagagcaactcgctgaatacattgttggttgggca
aaagagaaaggtttccatgtcgaacgcgatcaggtaggtaatatcctgattcgtaaacct
gctaccgcaggtatggaaaatcgtaaaccggtcgtcttacaggcccacctcgatatggtg
ccgcagaaaaataacgacaccgtgcatgacttcacgaaagatcctatccagccttatatt
gatggcgaatgggttaaagcgcgcggcaccacgctgggtgcggataacggcattggtatg
gcctctgcactggcagttctggctgacgaaaacgtggttcacggcccgctggaagtgctg
ctgaccatgaccgaagaagccggtatggacggtgcgttcggcttacagagcaactggttg
caggctgatattctgattaacaccgactccgaagaagaaggtgaaatctacatgggttgt
gcggggggtatcgacttcacctccaacctgcatttagatcgtgaagcggttccagctggt
tttgaaaccttcaagttaaccttaaaaggtctgaaagggggtcactccggcggggaaatc
cacgttggcctgggtaatgccaacaaactgctggtgcgcttcctggcgggtcatgcagaa
gaactggatctgcgccttatcgatttcaacggcggcacactgcgtaacgccatcccgcgt
gaagcctttgcgaccattgctgtcgcagctgataaagtcgacgtcctgaaatctctggtg
aatacctatcaggagatcctgaaaaacgagctggcagagaaagagaaaaatctggccttg
ttgctggactctgtagcgaacgataaagctgccctgattgcgaaatctcgcgataccttt
attcgtctgctgaacgccaccccgaacggtgtgatccgcaactcagacgtggcaaaaggt
gtggtcgaaacctccctgaacgtcggtgtggtgaccatgactgataataacgtagaaatt
cactgtctgatccgttcactgatcgacagcggtaaagactacgtggtgagcatgctggat
tcgctgggtaaactggctggcgcgaaaaccgaagcgaaaggcgcatatcctggctggcag
ccggacgctaattctccggtgatgcatctggtacgtgaaacctatcagcgtctgttcaac
aaaacgccgaacatccagattatccacgcgggcctggaatgtggtctgttcaaaaaaccg
tatccggaaatggacatggtttctatcgggccaactatcaccggtccacactctccggat
gagcaagttcacatcgaaagcgtaggtcattactggacactgctgactgaactgctgaaa
gaaattccggcgaagtaa

DBGET integrated database retrieval system