KEGG   Escherichia coli O9 HS (commensal): EcHS_A0265
Entry
EcHS_A0265        CDS       T00591                                 

Gene name
gpt
Definition
(GenBank) xanthine phosphoribosyltransferase
  KO
K00769  xanthine phosphoribosyltransferase [EC:2.4.2.22]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00230  Purine metabolism
ecx01100  Metabolic pathways
ecx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EcHS_A0265 (gpt)
Enzymes [BR:ecx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.22  xanthine phosphoribosyltransferase
     EcHS_A0265 (gpt)
SSDB
Motif
Pfam: Pribosyltran
Other DBs
NCBI-ProteinID: ABV04655
UniProt: A7ZWK1
Structure
PDB: 

Position
285623..286081
AA seq 152 aa
MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCI
SSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRP
LVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR
NT seq 459 nt   +upstreamnt  +downstreamnt
atgagcgaaaaatacatcgtcacctgggacatgttgcagatccatgcacgtaaactcgca
agccgactgatgccttctgaacaatggaaaggcattattgccgtaagccgtggcggtctg
gtaccgggtgcgttactggcgcgtgaactgggtattcgtcatgtcgataccgtttgtatt
tccagctacgatcacgacaaccagcgcgagcttaaagtgctgaaacgcgcagaaggcgat
ggcgaaggcttcatagttattgatgacctggtggataccggtggtactgctgttgcgatt
cgtgaaatgtatccaaaagcgcactttgtcaccatcttcgcaaaaccggctggtcgtccg
ctggttgatgactatgttgttgatatcccgcaagatacctggatcgaacagccgtgggat
atgggcgtcgtattcgtcccgccaatctccggtcgctaa

DBGET integrated database retrieval system