KEGG   Escherichia coli O9 HS (commensal): EcHS_A0266
Entry
EcHS_A0266        CDS       T00591                                 

Gene name
frsA
Definition
(GenBank) fermentation-respiration switch protein
  KO
K11750  esterase FrsA [EC:3.1.-.-]
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EcHS_A0266 (frsA)
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     EcHS_A0266 (frsA)
SSDB
Motif
Pfam: DUF1100 AXE1 Chlorophyllase2 DLH
Other DBs
NCBI-ProteinID: ABV04656
UniProt: A7ZWK2
Position
286173..287417
AA seq 414 aa
MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIPHWYRMINRLMWIWRG
IDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQAMVWQQKACAEEDPQL
SGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQRLPGTMRQMEFTVPGGAP
ITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRGIAMLTIDMPSVGFSSKWK
LTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVRLAYLESPRLKAVACLGPVV
HTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELNRYSLKVQGLLGRRCPTPMLS
GYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFDKGLQEITGWIEKRLC
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgacacaggcaaacctgagcgaaaccctgttcaaaccccgctttaaacatcctgaaacc
tcgacgctagtccgccgctttaatcacggcgcacaaccgcctgtgcagtcggctcttgat
ggtaaaaccatccctcactggtatcgcatgattaaccgtctgatgtggatctggcgcggt
attgacccacgtgaaatcctagacgtccaggcacgtattgtgatgagcgatgctgaacgt
accgacgatgatttgtacgatactgtgattggctaccgtggtggcaactggatttatgag
tgggccacccaggcgatggtgtggcaacaaaaagcctgtgcggaagaagatccgcaactc
agtggtcgacactggctgcatgcggctacgttgtacaacattgccgcctatcctcatctg
aaaggagatgacctggccgagcaagcgcaggctttatcaaaccgcgcctatgaagaggcc
gcccagcgtctgccgggcacgatgcggcagatggagtttaccgtacccggcggtgcgccc
atcaccggctttttgcatatgccgaaaggcgatggcccgttcccgacagtattaatgtgt
ggtggtctggatgcgatgcagacggactattacagcctgtatgaacgttattttgcgccg
cgcggcattgcgatgctgactattgatatgccgtcggtgggcttttcttcaaaatggaag
ctcacccaggactccagcctgttgcatcagcacgtcttaaaggcgctgcctaacgtaccg
tgggtggatcacactcgcgtcgcggcctttggtttccgtttcggcgctaacgttgccgtg
cgtctggcatatcttgaatcgccgcgtctgaaagcggttgcctgtcttggtccggtagtt
cataccctgttgagtgattttaagtgccagcaacaggtgccggaaatgtatcttgacgtt
ctggcgagtcgtttggggatgcatgatgcttccgacgaagcgttacgcgtggagctgaat
cgctattcattaaaagtgcaaggattgctgggacgtcgctgcccaacgccaatgttatca
ggctactggaagaacgatccgttcagcccggaagaggactcacgcttaatcacctcatca
tctgctgacggtaaattattagagatcccatttaacccggtgtatcggaattttgacaaa
ggtcttcaggaaatcaccggctggatcgaaaaacgcttgtgttaa

DBGET integrated database retrieval system