KEGG   Escherichia coli O9 HS (commensal): EcHS_A0268
Entry
EcHS_A0268        CDS       T00591                                 

Gene name
phoE
Definition
(GenBank) outer membrane pore protein E
  KO
K11929  outer membrane pore protein E
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecx02000]
    EcHS_A0268 (phoE)
Transporters [BR:ecx02000]
 Other transporters
  Pores ion channels [TC:1]
   EcHS_A0268 (phoE)
SSDB
Motif
Pfam: Porin_1 Porin_4 OMP_b-brl
Other DBs
NCBI-ProteinID: ABV04658
Structure
PDB: 
1PHO

Position
complement(287915..288970)
AA seq 351 aa
MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMSDNASKDGDQSYIRFG
FKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKYKDLGSFDYGRNLGALY
DVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVIDGLNLTLQYQGKNENRD
VKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSRGTGKRAEAWATGLKYDAN
NIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLRPSLGYVLSKGKDIEGIGGE
DLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINNDDIVAIGMTYQF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaaaaagagcactctggcattagtggtgatgggcattgtggcatctgcatctgtacag
gctgcagaaatatataataaagacggtaataaactggatgtctatggcaaagttaaagcc
atgcattatatgagtgataacgccagtaaagatggcgaccagagttatatccgttttggt
tttaaaggtgaaacacaaattaacgatcaactgactggttatggtcggtgggaagcggag
tttgccggaaataaagcggagagtgataccgcacagcaaaaaacgcgtctcgcttttgcc
ggattgaagtataaagatttgggttctttcgactatggccgtaacctgggcgcgttgtat
gacgtggaagcctggaccgatatgttcccggaatttggtggcgactcctcggcgcagacc
gacaactttatgaccaaacgcgccagcggtctggcgacgtatcggaacaccgacttcttc
ggcgttatcgatggcctgaacttaaccctgcaatatcaagggaaaaacgaaaaccgcgac
gttaaaaagcaaaacggcgatggcttcggcacgtcattgacatatgactttggcggcagc
gatttcgccattagtggtgcctataccaactcagatcgcaccaacgagcagaacctgcaa
agccgtggcactggcaagcgtgcagaagcatgggcaacaggtctgaaatacgatgccaat
aatatttatctggcaactttctattctgaaactcgcaaaatgacgccaataactggcggc
tttgccaataagacacagaactttgaagcggtcgctcaataccagtttgactttggtctg
cgtccatcgctgggttatgtcttatcgaaagggaaagatattgagggcatcggtggtgaa
gatctggttaattatatcgacgtcggtgctacgtattatttcaacaaaaatatgtcagca
tttgttgattataaaatcaaccaactggatagcgataacaaattgaatattaataatgat
gatattgtcgcgattgggatgacgtatcagttttaa

DBGET integrated database retrieval system