KEGG   Escherichia coli O9 HS (commensal): EcHS_A0270
Entry
EcHS_A0270        CDS       T00591                                 

Gene name
proA
Definition
(GenBank) gamma-glutamyl phosphate reductase
  KO
K00147  glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00330  Arginine and proline metabolism
ecx00332  Carbapenem biosynthesis
ecx01100  Metabolic pathways
ecx01110  Biosynthesis of secondary metabolites
ecx01230  Biosynthesis of amino acids
Module
ecx_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    EcHS_A0270 (proA)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    EcHS_A0270 (proA)
Enzymes [BR:ecx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     EcHS_A0270 (proA)
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-ProteinID: ABV04660
UniProt: A7ZWK6
Position
290373..291626
AA seq 417 aa
MLEQMGIAAKQASYKLAQLSSREKNRVLEKIADELEAQSEIILNANAQDVADARANGLGE
AMLDRLALTPARLKGIADDVRQVCNLADPVGQVIDGSVLDSGLRLERRRVPLGVIGVIYE
ARPNVTVDVASLCLKTGNAVILRGGKETCRTNAATVAVIQDALKSCGLPAGAVQAIDNPD
RALVSEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGIGVCHIYVDESVEIAEALK
VIVNAKTQRPSTCNTVETLLVNKNIADSFLPALSKQMAESGVTLHADAAALAQLQAGPAK
VVAVKAEEYDDEFLSLDLNVKIVSDLDDAIAHIREHGTQHSDAILTRDMRNAQRFVNEVD
SSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLEALTTYKWIGIGDYTIRA
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgctggaacaaatgggcattgccgcgaagcaagcctcgtataaattagcgcaactctcc
agccgcgaaaaaaatcgcgtgctggaaaaaatcgccgatgaactggaagcacaaagcgaa
atcatcctcaacgctaacgcccaggatgttgctgacgcgcgtgccaatggccttggcgaa
gcgatgcttgaccgtctggcactgacgcccgcacggctgaaaggcattgccgatgatgtg
cgccaggtgtgtaacctcgccgatccggtggggcaggtaatcgatggcagcgtactggac
agcggcctgcgtcttgagcgtcgtcgcgtaccgctgggggttattggcgtgatttatgaa
gcgcgcccgaacgtgacggttgatgtcgcttcgctgtgcctgaaaaccggtaatgcggtg
atcctgcgcggtggcaaagaaacgtgtcgcactaacgctgcaacggtggcggtgattcag
gacgccctgaaatcctgcggcttaccggcgggtgccgtgcaggcgattgataatcctgac
cgtgcgctggtcagtgaaatgctgcgtatggataaatacatcgacatgctgatcccgcgt
ggtggcgctggtttgcataaactgtgccgtgaacagtcgacaatcccggtgatcacaggt
ggtataggcgtatgccatatttacgttgatgaaagtgtagagatcgctgaagcattaaaa
gtgatcgtcaacgcgaaaactcagcgtccgagcacatgtaatacggttgaaacgttgctg
gtgaataaaaacatcgccgatagcttcctgcccgcattaagcaaacaaatggcggaaagc
ggcgtgacattacacgcagatgcagctgcactggcgcagttgcaggcaggccctgcgaag
gtggttgctgttaaagccgaagagtatgacgatgagtttctgtcattagatttgaacgtc
aaaatcgtcagcgatcttgacgatgccatcgcccatattcgtgaacacggcacacaacac
tccgatgcgatcctgacccgcgatatgcgcaacgcccagcgttttgttaacgaagtggat
tcgtccgctgtttacgttaacgcctctacgcgttttaccgacggcggccagtttggtctg
ggtgcggaagtggcggtaagcacacaaaaactccacgcgcgtggcccaatggggctggaa
gcactgaccacttacaagtggatcggcattggtgattacaccattcgtgcgtaa

DBGET integrated database retrieval system