KEGG   Escherichia coli O9 HS (commensal): EcHS_A0272
Entry
EcHS_A0272        CDS       T00591                                 

Definition
(GenBank) site-specific recombinase, phage integrase family
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Phage_integrase Phage_int_SAM_5
Other DBs
NCBI-ProteinID: ABV04661
Position
complement(291831..292991)
AA seq 386 aa
MSIKLRGGTWHCDFVAPDGSRVRRSLETSDKRQAQELHDRLKAEAWRVKNLGESPKKLFK
EACIRWLREKSDKKSIDDDKSIISFWMLHFRETILSDITTEKIMEAVDGMENRRHRLNWE
MSRDRCLRLGKPVPEYKPKLASKGTKTRHLAILRAILNMAVEWGWLDRAPKISTPRVKNG
RIRWLTEEESKRLFAEIAPHFFPVVMFAITTGLRRSNVTDLEWSQVDLDKKMAWMHPDET
KAGNAIGVPLNETACQILRKQQGLHKRWVFVHTKPAYRSDGTKTAAVRKMRTDSNKAWKG
ALKRAGISNFRFHDLRHTWASWLVQSGVSLLALKEMGGWETLEMVQRYAHLSAGHLTEHA
SKIDAIISRNGTNTAQEENVVYLNAR
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgtcaatcaaactacgcggtggcacgtggcactgcgatttcgtcgcgccagatggatca
agagttagacgctctcttgaaacatcggacaaaaggcaagcgcaagaacttcacgatcgt
ctgaaagcagaagcgtggagagtaaaaaatctcggggaatcaccgaaaaagctattcaag
gaagcctgcatacggtggctgcgtgagaaatcggataagaagtccattgatgatgacaag
agcattatatcgttctggatgttgcacttcagagaaaccattctctcagacataacaaca
gaaaaaataatggaggcggtagacgggatggaaaaccgccgccatcgcctgaactgggaa
atgagccgggacaggtgtttgcggcttggcaagccagtgccggagtataaaccaaagctg
gcaagcaaaggaacgaagacgcggcatctggcaatacttcgcgctattctcaatatggct
gttgaatggggatggcttgacagggcgcccaaaatatcaacaccacgcgttaagaatgga
cgaatcagatggcttacagaggaggaatcgaagcgcctgtttgcagaaattgctcctcat
ttcttccctgtggtcatgtttgcaatcacgacaggccttcgccgttccaacgttacagac
cttgagtggtcacaggtcgatctggataagaaaatggcatggatgcaccctgatgaaaca
aaagctggcaatgcgatcggagttcctcttaacgaaaccgcatgccagatattaagaaaa
cagcagggtctccataagagatgggtgtttgtccacaccaaacctgcctaccgaagcgac
ggaacaaaaacagcagcggtaaggaagatgagaaccgacagcaacaaggcatggaaggga
gcgttaaagcgggcaggcattagcaacttccgcttccatgacctgaggcatacctgggca
agctggctggttcagtctggtgtctctcttcttgcacttaaagagatgggaggatgggaa
actctcgaaatggttcaaagatacgcccacctttcagccgggcatctcaccgagcacgca
agcaaaatcgatgcgattataagtcgcaatggcacaaatacggcacaagaggagaacgtg
gtttacttaaatgcgaggtaa

DBGET integrated database retrieval system