KEGG   Escherichia coli O9 HS (commensal): EcHS_A0274
Entry
EcHS_A0274        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: DUF550 DUF551
Other DBs
NCBI-ProteinID: ABV04663
Position
complement(293833..294474)
AA seq 213 aa
MSAITKERIKLFIKNPLDNGLTRGEQMELARIALASLEREQIRHEHAKWSDSTFGCVGPI
GPLKHLSKEALEAAAEPDDLSEWADMQFLLWDAQRRAGISDAEITAAMENKLKINMERQW
PEPKDGEPRLHIKERGNSPVTPGSWISCSDRMPEDTKMLLAFSQGEIVAAYWNWVVNPID
YKKYRAFTYLSGNILDDVTHWMPLPEPPEQDGE
NT seq 642 nt   +upstreamnt  +downstreamnt
atgagcgctataaccaaagaacgtatcaaattattcattaaaaatccgcttgataacgga
cttactcgtggcgaacaaatggaactggcacgaattgcactggcatcactggaacgcgaa
cagattcgccacgagcatgccaaatggtctgactccacatttggctgcgttggccccatt
ggtccgctgaaacatctctcaaaagaggcactggaagccgcagccgaaccagacgatctt
agcgagtgggctgatatgcagtttctgttgtgggatgcacagcgccgtgctggtatcagt
gatgctgaaattaccgctgctatggaaaataaattgaagatcaacatggaacgccagtgg
cctgaaccaaaagatggtgagcctcgcttgcacattaaagaacgcggcaactctccggta
actccgggtagttggataagctgtagtgatcgaatgccggaagacaccaaaatgttactg
gcatttagtcaaggtgaaatcgtggccgcatattggaactgggttgtaaatccaattgat
tacaaaaaatatagagctttcacgtatttatcaggaaatatcttggatgacgtaactcac
tggatgccgctgccagaaccgccggagcaggatggtgaatga

DBGET integrated database retrieval system