KEGG   Escherichia coli O9 HS (commensal): EcHS_A0275
Entry
EcHS_A0275        CDS       T00591                                 

Definition
(GenBank) putative phage protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Ead_Ea22 DUF724 DUF5798 Lipoprotein_20
Other DBs
NCBI-ProteinID: ABV04664
Position
complement(294476..295159)
AA seq 227 aa
MTIDYQALREAAERAIPAMERLLMLPADDDLLSEQELKDYGVDIDALNAFKFLAGPETVL
ALLDERERNQQYIKRRDQENEDIALTVGKLRVELEGKDSKIANLTAERDALREGEMGDAR
HSNTRAAADIYFQLVEECEIPAGGSLVEYVDDMREKLEAAEKRIAELESDSQAQKLVEAI
IVAIENEQERLFDEDYLMDSKECIDVIREEVKRWNDSRTAGIRIKGE
NT seq 684 nt   +upstreamnt  +downstreamnt
atgacaattgactatcaggcactacgtgaggcggcggaacgtgcaattccagcaatggaa
cgcctgttaatgttgccagctgatgatgatttgttaagtgaacaggaacttaaagattac
ggtgtggatattgatgcgctcaacgccttcaaatttctggccggaccagaaaccgtgctg
gcactactggatgaacgggaaagaaaccagcaatacatcaaacgccgtgaccaggagaac
gaggatattgctcttacggttgggaagctgagagttgagctggaaggcaaagacagcaaa
atagccaatcttaccgccgaacgcgatgctcttcgtgaaggtgagatgggcgacgctagg
catagcaacacacgggccgcagctgatatctacttccaactggtcgaggagtgcgaaatt
cctgctggcggatctctggtcgagtacgttgacgatatgcgcgagaagttggaagccgca
gagaagcgcatagcagagttagaaagtgattctcaggcacaaaagttagttgaagcaatc
attgttgcgatagaaaacgaacaggaacgtctttttgatgaagattacctaatggattcg
aaagaatgcattgacgtaattcgtgaagaagtaaagcgatggaatgattcccgcaccgct
ggcattcgcatcaaaggagagtga

DBGET integrated database retrieval system