KEGG   Escherichia coli O9 HS (commensal): EcHS_A0277
Entry
EcHS_A0277        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: DUF2737
Other DBs
NCBI-ProteinID: ABV04666
Position
complement(295797..295964)
AA seq 55 aa
MRGLAYNPGILPAEMIIRQRVKPMPSREELLKRNSFPSVNQNKYLNAMWRKGGNQ
NT seq 168 nt   +upstreamnt  +downstreamnt
atgagaggacttgcatacaatcccggcattcttccggcagaaatgattattcgccaacgc
gtaaagccaatgccatcgagagaggaattgcttaagagaaattcttttccatcagtaaat
caaaacaaatatctgaatgcgatgtggcgtaaaggaggcaaccagtga

DBGET integrated database retrieval system