KEGG   Escherichia coli O9 HS (commensal): EcHS_A0278
Entry
EcHS_A0278        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: HTH_12 GerE DUF123 Mannosyl_trans3
Other DBs
NCBI-ProteinID: ABV04667
Position
complement(295981..296295)
AA seq 104 aa
MKKNPWEKWEVDFLREVAATMPVEVIAEKLERTEKAVMAKATRIGADIVSRLRGRRWTRA
EVSLFGKFSAEEIAIATCRSIYSVRAMRYKLKKLDEERAGIRIN
NT seq 315 nt   +upstreamnt  +downstreamnt
atgaaaaagaatccatgggagaaatgggaagtcgatttcttacgcgaagtagcggcgaca
atgccagttgaagttatcgctgaaaaactggaaaggactgaaaaagcagtaatggcgaaa
gcaacaaggattggcgctgacattgttagccgacttcgtggaagacgatggacaagagcc
gaagtatcacttttcggtaagttctccgcagaagaaatagcaattgcaacctgccgctca
atttattcagtaagggctatgcgatacaagctaaaaaaactcgatgaagaaagagcaggc
atacgaataaattaa

DBGET integrated database retrieval system