KEGG   Escherichia coli O9 HS (commensal): EcHS_A0279
Entry
EcHS_A0279        CDS       T00591                                 

Definition
(GenBank) putative phage protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Sipho_Gp157 Phage_Mu_Gam
Other DBs
NCBI-ProteinID: ABV04668
Position
complement(296307..296666)
AA seq 119 aa
MSVKPVAIHGYAERLKEEAKSLNERAAVIQNKIDSIMTYIASSLEMVGKKKIRAGIHQVT
IRKPSETVEIIDSSALPPEYVEFETTIKADKLAIKHQLKAGINIPGAQLKVGKPSLLIK
NT seq 360 nt   +upstreamnt  +downstreamnt
gtgtctgttaaacccgtggcgattcatggttatgctgaacgcctcaaggaagaggcaaag
tcactgaatgaaagagcagcagtaattcaaaataagattgatagcattatgacgtatata
gcgtcatcgcttgaaatggttggaaagaaaaagattcgagcaggtattcaccaggtaaca
atccgcaaaccgtcagaaactgtagaaatcatcgactcaagcgcccttcctccagaatac
gttgagtttgaaacaacaattaaagccgacaaactggcaatcaaacaccaactaaaagca
ggaataaatatccccggcgctcaactcaaagttgggaaaccttcacttcttatcaaataa

DBGET integrated database retrieval system