KEGG   Escherichia coli O9 HS (commensal): EcHS_A0282
Entry
EcHS_A0282        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Sipho_Gp157 TRM
Other DBs
NCBI-ProteinID: ABV04671
Position
complement(297848..298021)
AA seq 57 aa
MSKLYEIANEYAKLMDSDLEPEMIADTIEGMEGEFTDKIEQLLAIIKNESGESPRII
NT seq 174 nt   +upstreamnt  +downstreamnt
gtgagcaaactgtatgaaattgccaatgaatacgcaaaattgatggattcagatttagag
ccagagatgattgctgacacaatagaaggcatggaaggagaatttaccgataaaatagag
caacttcttgccattattaaaaatgagtctggtgaatcgccacggataatctag

DBGET integrated database retrieval system