KEGG   Escherichia coli O9 HS (commensal): EcHS_A0283
Entry
EcHS_A0283        CDS       T00591                                 

Definition
(GenBank) RecT family protein
  KO
K07455  recombination protein RecT
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecx03400]
    EcHS_A0283
DNA repair and recombination proteins [BR:ecx03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EcHS_A0283
SSDB
Motif
Pfam: RecT
Other DBs
NCBI-ProteinID: ABV04672
Position
complement(298005..298907)
AA seq 300 aa
MSNIVEFVKQQEQLFCGALTEQTVTWAKESQFAIQYFQKNDYLAKTALANPTSAQNAIIN
VAAIGITLNPASKLAYLVPRDGMVCLDISYMGLLHLAQSTGSIKWGQCKLVYSNDTYESN
GLDSAPTHKYNAFGERGSIVGGYCTVKTADGDYLTEEMSLAEIKAVEATSKAKNGPWKTF
WEEMARKTIVKRASKYWPKAQRLDNAIHLLNEDEGMHQEPVMPHKSEEDIREDERKRQQE
IMEKAQLLCDEMTQAENMDDLKRYFAEAYRLTSGMKLQQNIQAIYAECKAKLEVASEQTV
NT seq 903 nt   +upstreamnt  +downstreamnt
atgagcaatatcgttgaattcgttaaacagcaggagcagttattctgcggagcattgact
gaacagacggtgacatgggctaaggaaagccagtttgcaattcagtatttccagaaaaat
gattacctggctaaaacggcactggcaaatccaaccagcgcacagaacgccatcatcaat
gttgcggcgatcggtatcaccttaaacccggctagcaaactggcttatctggttccgcgc
gacggcatggtttgccttgatatcagttacatggggttacttcatcttgcgcaatcgaca
ggatcaattaagtgggggcaatgcaaactggtgtactcaaacgacacctatgaatcaaat
ggccttgattcagcaccaacccacaaatacaacgcatttggtgagcgaggctctattgtt
ggtggttattgtacggttaaaacagcagatggtgactacctgactgaagaaatgagtctg
gcagaaattaaagctgtggaagcaacgagcaaggcaaagaatggaccgtggaaaacattc
tgggaagagatggcacgtaaaacaatagttaaacgcgccagcaaatactggcctaaagcc
cagcgactggataatgccattcacctgcttaacgaagatgaaggtatgcatcaggaacca
gttatgccgcacaaatcagaggaagatatccgcgaagatgaacggaaacgccagcaggaa
ataatggaaaaagcacaacttctttgtgatgaaatgactcaggctgaaaacatggatgat
ttgaagagatattttgcagaagcatatcgcctgacatctggaatgaaattgcagcagaac
atacaagccatttacgcagaatgcaaagcgaaactggaggttgccagtgagcaaactgta
tga

DBGET integrated database retrieval system