KEGG   Escherichia coli O9 HS (commensal): EcHS_A0284
Entry
EcHS_A0284        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: EndoU_bacteria
Other DBs
NCBI-ProteinID: ABV04673
Position
complement(299193..299330)
AA seq 45 aa
MGYFETTRPSMSFTDNWSDEEFIRQMNKMLNQHKEQEKDDDSDSE
NT seq 138 nt   +upstreamnt  +downstreamnt
ttgggatattttgaaacaacaaggccgtccatgagttttacagataactggtcagacgaa
gaattcattcgtcagatgaacaaaatgctcaatcagcacaaagaacaggagaaagatgat
gattctgactctgaatga

DBGET integrated database retrieval system