KEGG   Escherichia coli O9 HS (commensal): EcHS_A0286
Entry
EcHS_A0286        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04675
Position
complement(300094..300345)
AA seq 83 aa
MEFHESAIYDFRANANSVKPQPIAVLFKTMGAWAVLCFAADDTDARMAIGQEMEMDPTND
EFIIYGAPSNYLLDTCNIYNKAA
NT seq 252 nt   +upstreamnt  +downstreamnt
atggaatttcatgaaagtgcgatttatgattttcgcgctaacgcaaattcagtaaaacca
cagccaattgcagttctttttaaaacaatgggtgcgtgggctgttttatgcttcgccgct
gatgacactgacgcaagaatggcaataggccaagagatggagatggacccgacaaacgat
gaattcataatttatggcgctccatctaattacttacttgatacctgcaacatttacaac
aaggctgcctga

DBGET integrated database retrieval system