KEGG   Escherichia coli O9 HS (commensal): EcHS_A0288
Entry
EcHS_A0288        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04677
Position
complement(300820..301125)
AA seq 101 aa
MVTIVWKESKGTAKSRYKARRAELIAERRSNEALARKIALKLSGCVRADKAASLGSLCCK
KKEEVVRKNRSIYYKDSNPLGNKIHAVQKIKLYSKLPYGAY
NT seq 306 nt   +upstreamnt  +downstreamnt
atggtaaccattgtctggaaagaatccaaaggtacggcaaaaagccgctacaaagctcgc
agagcagaacttattgccgagcgacgcagtaatgaagcactggcgcgaaaaattgcgcta
aagctctctggttgcgtcagagcagacaaagcagcatcactaggaagcctttgctgcaag
aagaaagaagaagtcgttcgaaaaaatagaagtatttattacaaagattcaaacccatta
ggaaacaaaatacatgcagtccaaaaaataaaattgtacagtaaactaccgtacggtgct
tattga

DBGET integrated database retrieval system