KEGG   Escherichia coli O9 HS (commensal): EcHS_A0289
Entry
EcHS_A0289        CDS       T00591                                 

Gene name
c2
Definition
(GenBank) P22 repressor protein c2
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Peptidase_S24 HTH_3 HTH_19 HTH_31 MqsA_antitoxin HTH_26 Phage_CI_repr P22_Cro
Other DBs
NCBI-ProteinID: ABV04678
Position
complement(301440..302090)
AA seq 216 aa
MNTQLMGERIRARRKELKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALAKALQCS
PDYLLKGEDSLSNIAYHSRHDPRGSYPLISWVSAGCWMEAVEPYHRRAIDNWYDTTVDCS
EDSFWLDVKGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVAKLEGENEATFKKLVIDA
GRKFLKPLNPQYPMIEINGNCKIIGVVVDAKLANLP
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaatacacaactgatgggtgagcgtattcgcgctcgcagaaaagaactcaagattagg
caggctgcccttggcaagatggttggcgtgtctaatgttgctatttcccaatgggagcga
tctgaaactgagcccaatggcgaaaacctattggccttagccaaggctttgcagtgctcc
cctgattacctgttgaaaggagaggatagtctttcaaacattgcctatcacagcaggcat
gatccaagaggttcgtatcctctaattagttgggtaagcgcaggatgttggatggaagct
gtagagccatatcataggcgtgcaatagataactggtacgacacaacggtagattgttct
gaagactctttttggctcgacgttaaaggcgattcaatgactgccccggcaggactgagt
attcctgaggggatgattattctcgtcgacccagaagtcgaaccacgtaatggaaagctg
gtagtcgccaaacttgaaggagaaaacgaggcgacattcaaaaagttagttattgatgcc
ggtagaaaattcctgaaaccactcaatccacaatacccaatgattgaaatcaatgggaac
tgtaaaatcattggcgttgtcgttgatgccaagctagcaaaccttccttaa

DBGET integrated database retrieval system