KEGG   Escherichia coli O9 HS (commensal): EcHS_A0290
Entry
EcHS_A0290        CDS       T00591                                 

Gene name
cro
Definition
(GenBank) regulatory protein Cro
  KO
K22302  transcriptional repressor of cell division inhibition gene dicB
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecx03000]
    EcHS_A0290 (cro)
Transcription factors [BR:ecx03000]
 Prokaryotic type
  Other transcription factors
   Others
    EcHS_A0290 (cro)
SSDB
Motif
Pfam: P22_Cro YdaS_antitoxin HTH_28 HTH_50 HTH_3 BrkDBD Phage_CII HTH_23 DUF739
Other DBs
NCBI-ProteinID: ABV04679
Position
302171..302356
AA seq 61 aa
MYKKDVIDHFGTQRAVAKALGISDAAVSQWKEVIPEKDAYRLEIVTAGALKYQESAYRQA
A
NT seq 186 nt   +upstreamnt  +downstreamnt
atgtacaaaaaagatgttattgaccacttcggaacccagcgtgctgttgctaaagcacta
ggcattagcgatgcagcagtctctcagtggaaagaagttatcccagagaaagacgcctat
cgattggaaatcgttacagctggcgccctgaagtatcaagaaagtgcttaccgccaagcg
gcataa

DBGET integrated database retrieval system