KEGG   Escherichia coli O9 HS (commensal): EcHS_A0291
Entry
EcHS_A0291        CDS       T00591                                 

Definition
(GenBank) bacteriophage CII protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Phage_CII DUF3976
Other DBs
NCBI-ProteinID: ABV04680
Position
302472..302768
AA seq 98 aa
MAQASYSKPTQREIDRAETDLLINLSTLTQRGLAKMIGCHESKISRTDWRFIASVLCAFG
MASDISPISRAFKYALDEITKKKSPAATEDFKQIDMQF
NT seq 297 nt   +upstreamnt  +downstreamnt
atggcacaagcaagctacagcaagccaacacagcgagaaattgatcgcgctgaaacagat
ttactcatcaacctgtcaacgcttacccagcgcggtctggcaaagatgattggctgtcat
gaatcgaagataagcagaacggactggagatttattgcttcggtcttgtgtgctttcgga
atggcatcagacatcagtccgattagcagggcttttaagtatgcgcttgatgaaatcaca
aagaaaaaatccccggctgccaccgaggattttaagcaaattgatatgcaattctga

DBGET integrated database retrieval system