KEGG   Escherichia coli O9 HS (commensal): EcHS_A0292
Entry
EcHS_A0292        CDS       T00591                                 

Definition
(GenBank) putative replication protein O
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Phage_rep_org_N
Other DBs
NCBI-ProteinID: ABV04681
Position
302940..303839
AA seq 299 aa
MSNISNLAEAREARRLQQPHQSSGKGYALLHRKIMDVPFYKDAEAAHLWVHLILKAKHTP
EYVMTDAGEILVGRGKLLGGRNSLAFETGLKPDRVQYLLRKFKKLGMIDWVSHGKFSVFS
VEKYDDYQSNFVPADYQQITTSKPAIPLPVSNTVPADYQQITTDKEYNNIISNTDVLESA
TADKKSDKKKPSVSCQDVVDAYHEILPEAPRIRALNDKRKNQIRTFWRKAGVITRQLDGH
GFTMQDWRNYLSYVGENCRWMFEERPNHQRGTVWHKKGFDFLLNDNTYLKVREGEHDDR
NT seq 900 nt   +upstreamnt  +downstreamnt
atgagtaacatatctaatctagccgaagccagagaggccagaaggctacaacaaccgcat
caaagcagcggtaaggggtatgccttgctgcaccgtaaaattatggatgtgccgttttac
aaggacgcagaagcagcgcatctgtgggttcacttaatcctcaaagcaaagcatacgcct
gagtatgtaatgactgacgcaggagaaattctggtaggcagagggaagctacttggcggt
agaaactctctggcgtttgaaacaggactcaaaccagatcgcgttcagtacctgcttaga
aagttcaaaaaactcggcatgattgactgggtttcacacggtaaattctcagttttctcg
gtagagaaatatgacgattatcagtcaaattttgtaccagcagattaccagcaaattacc
acctcaaagccagcaataccattgcctgtaagcaatactgtaccagcagattaccagcaa
attaccacagataaagaatataataatattatctctaatactgacgtattagagagtgcc
acagcagacaaaaagtctgacaagaaaaaaccttccgtcagctgtcaggatgtagtcgat
gcttaccacgaaatccttcctgaagcgccaagaatccgcgcactgaatgacaagcgtaaa
aaccagatccgaacgttctggcgcaaagccggagtgataacccgccagcttgacgggcat
gggttcacgatgcaggactggagaaattatttgagctacgtaggcgaaaattgccgatgg
atgttcgaagaacgcccaaaccatcaacgcggaaccgtctggcacaaaaagggatttgat
ttcctgcttaacgataatacctacctgaaagttcgtgagggtgaacacgatgaccgataa

DBGET integrated database retrieval system