KEGG   Escherichia coli O9 HS (commensal): EcHS_A0293
Entry
EcHS_A0293        CDS       T00591                                 

Definition
(GenBank) replicative DNA helicase homolog
  KO
K02314  replicative DNA helicase [EC:3.6.4.12]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx03030  DNA replication
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EcHS_A0293
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecx03032]
    EcHS_A0293
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EcHS_A0293
DNA replication proteins [BR:ecx03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    EcHS_A0293
SSDB
Motif
Pfam: DnaB_C DnaB AAA_25 ATPase
Other DBs
NCBI-ProteinID: ABV04682
Position
303829..305265
AA seq 478 aa
MTDNFYAPPHSIEAEQAVIGGLLLDDDSSERVQKVLAMLKPDSFYSRPHKIIFEEITRMH
REQKPVDGLTLFDELERKSLTASVGGFAYIAEIAKNTPSAANIVAYAMQVRETAMERYAI
NRMTEATELLYSRNGMTATQKYEAIQAIFTQLTDHAKTGSRRGLRSFGEVMEDWVSDLEK
RFDPSGEQRGMSTGIPSLDRMLSPKGLVKGSLFVIGARPKMGKTTLYSQMAINCAVHEKK
PALMFSLEMPGDQILEKLVGQKSGVNPNIFYLPATNDADDGYQGDYDGDFNRAIETANRL
SEIDMLYIDDTPGLSLAQIVSESRRIKREKGCVGMILVDYLTLMTAEKADRNDLAYGMIT
KGLKNLAKELDCVVVLLTQLNRALESRTNKRPLPSDSRDTGQIEQDCDYWVGIHREGAFD
DSVPPGETELILRLNRHGNTGTVYCIQANGAIYDTDQQSAEMRRREREEPQSKKKGGF
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgaccgataatttttatgcgccgccccatagcatcgaggcagagcaggcggtgattggt
ggattgcttctggatgatgacagcagtgagcgcgtccagaaagttctggcgatgctgaag
cctgattcattttacagccgaccacacaaaatcattttcgaagaaataaccagaatgcac
cgggagcaaaagccagtagatggcctgacgcttttcgatgaactggagcgtaaatcgtta
acggcgtctgttggcggttttgcttatatcgctgagatcgcaaagaacacgccaagcgcc
gcaaacatcgttgcctatgcaatgcaggttcgcgaaaccgcaatggaacgctacgccatc
aaccgcatgactgaagcgacggaattgctctattcccgcaacggaatgactgcaacgcag
aagtacgaagctattcaggcgattttcacgcaactgacagaccatgcaaaaaccggatcg
cgtcgcggccttcgctcatttggtgaggtcatggaagactgggttagcgaccttgagaag
cgatttgacccgtcaggcgaacaacgaggaatgagcacagggatcccatctctggacagg
atgctgtcaccgaaaggtctggtgaaaggctctctgttcgtcattggcgctcgccctaag
atggggaaaacgacgctatacagccagatggcaatcaactgcgcagtgcatgagaaaaag
cccgctctgatgttcagtcttgaaatgcctggcgaccagatactggaaaagctggtagga
cagaagtcaggtgttaacccgaatattttttaccttccggcgacaaatgacgccgatgac
ggctatcagggtgattacgatggtgacttcaacagggcgatcgaaacagccaatcgcttg
agtgaaatcgacatgctttacatcgacgacacgccgggattatctctggctcaaatcgtc
agcgaaagccgtcgaatcaagcgagaaaaaggatgtgttggcatgattctggtcgattac
ctgacactaatgaccgctgagaaggccgatcgcaacgaccttgcttacggcatgatcacc
aaaggactgaagaaccttgccaaagagcttgattgcgttgttgtgcttctgacacagctt
aaccgcgcactggaaagccgaaccaataaacgcccattaccaagtgactcacgagataca
gggcagattgaacaggattgcgattattgggtggggatccatcgtgaaggtgcttttgat
gacagtgttccacctggtgaaaccgaactaatccttcgtctcaatcgtcatggcaatacc
ggcacggtgtattgcattcaggcaaatggcgctatttatgacacagaccaacagtctgct
gaaatgcgccgccgtgaacgcgaggaaccgcaatccaagaagaaaggaggattctga

DBGET integrated database retrieval system