KEGG   Escherichia coli O9 HS (commensal): EcHS_A0294
Entry
EcHS_A0294        CDS       T00591                                 

Definition
(GenBank) putative ninB protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: NinB
Other DBs
NCBI-ProteinID: ABV04683
Position
305342..305782
AA seq 146 aa
MKKLTFEIRSPAHQQNAIHAVQQILPDPTKPIVVTIQERNRSLDQNRKLWACLGDVSRQV
EWHGRWLDAESWKCVFTAALKQQDVVPNLAGNGFVVIGQSTSRMRVSEFAELLELIQAFG
TERGVKWSDEARLALEWKARWGDRAA
NT seq 441 nt   +upstreamnt  +downstreamnt
atgaaaaaactaacctttgaaattcgatctccggcacatcagcaaaacgctattcacgca
gtacagcaaatccttccagacccaaccaaaccaatcgtagtaaccattcaggagcgcaac
cgcagcttagaccaaaatcggaagctttgggcttgccttggtgacgtttcgcgtcaggtt
gaatggcatggtcgctggctggatgcagaaagctggaagtgcgtttttacagcagcatta
aagcagcaggacgttgttcctaaccttgccgggaatggctttgtggtaataggccagtca
accagcaggatgcgtgtaagcgaatttgcggagctattagagcttatacaggcattcggt
acagagcgtggcgttaagtggtcagacgaagcgcgactggctctcgaatggaaagcgcga
tggggagatcgggcagcatga

DBGET integrated database retrieval system