KEGG   Escherichia coli O9 HS (commensal): EcHS_A0295
Entry
EcHS_A0295        CDS       T00591                                 

Definition
(GenBank) NINE Protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: NinE
Other DBs
NCBI-ProteinID: ABV04684
Position
305919..306095
AA seq 58 aa
MARQRRSITDIICENCKYLPTKRSRNKCKPIPKESDVKTFNYTAHLWDIRWLRYRARK
NT seq 177 nt   +upstreamnt  +downstreamnt
gtggcgagacagcgacgaagtatcaccgacataatctgcgaaaactgcaaataccttcca
acgaagcgctccagaaataaatgcaagccaatcccaaaagaatctgacgtaaaaaccttc
aattacacagctcacctgtgggatatccggtggctaagatatcgtgcgaggaaatga

DBGET integrated database retrieval system