KEGG   Escherichia coli O9 HS (commensal): EcHS_A0296
Entry
EcHS_A0296        CDS       T00591                                 

Definition
(GenBank) putative protein ninX
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: DUF2591
Other DBs
NCBI-ProteinID: ABV04685
Position
306098..306457
AA seq 119 aa
MDYSQLSDFEINVAVFEAIHNGSPDYKEGENGDMVFVSFEGDIVNGDAVEVEVERGSFNP
CANPADAWPIIEKYRISIINLDEDEWGARGVAYCKSKRAIHENPLRSAMIVFLMMQRIQ
NT seq 360 nt   +upstreamnt  +downstreamnt
atggattattcacagttaagtgattttgaaattaacgtggcggtattcgaagccattcat
aacggatcaccggattacaaagaaggtgagaatggcgatatggtgtttgtctcatttgag
ggagacattgtaaacggagacgcagttgaagtagaagttgagcgcggatcctttaaccca
tgcgcaaacccagcagacgcatggccgattattgaaaaatacaggattagcattatcaat
ctcgatgaagacgagtggggtgcacgcggtgtggcctactgtaaatctaagcgagctata
catgaaaatcccctccgctccgccatgattgtctttctcatgatgcagagaatccaataa

DBGET integrated database retrieval system