KEGG   Escherichia coli O9 HS (commensal): EcHS_A0297
Entry
EcHS_A0297        CDS       T00591                                 

Definition
(GenBank) putative phage protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: NinF DZR_2 DZR OrfB_Zn_ribbon NitrOD2 DUF2614
Other DBs
NCBI-ProteinID: ABV04686
Position
306457..306633
AA seq 58 aa
MISPSQSIQYQKESVERALTCANCGQKLHVLEVHVCEHCCAELMSDPNSSMYEEEDDE
NT seq 177 nt   +upstreamnt  +downstreamnt
atgattagcccatcccaatccattcaataccagaaagaaagcgtcgagcgggctttaacg
tgcgctaactgcggtcagaagctgcatgtgcttgaagttcacgtgtgtgagcactgctgc
gcagaactgatgagcgatccgaatagctcaatgtacgaggaagaagacgatgagtga

DBGET integrated database retrieval system