KEGG   Escherichia coli O9 HS (commensal): EcHS_A0299
Entry
EcHS_A0299        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: DUF1364
Other DBs
NCBI-ProteinID: ABV04688
Position
306895..307185
AA seq 96 aa
MANLRKEARGRECQVRIYGVCNGNPETTVLAHYRMAGICGTGMKPDDLIGAWACSACHDE
IDRRTHNLDNKDARLYHLEGVIRTQAILLKEGKIKP
NT seq 291 nt   +upstreamnt  +downstreamnt
atggctaacctacgcaaagaagcgcgcggcagagaatgccaggtacgtatttacggcgta
tgcaatggcaatcctgaaactacagttctggcacattaccggatggctggaatttgcgga
acgggaatgaagcctgacgacctgatcggcgcatgggcttgtagcgcgtgtcacgatgaa
atcgaccgacgcacccataatctcgacaacaaagacgccagactttaccacctcgaaggc
gtgatcaggacgcaggcgatactgctgaaggaggggaagattaagccatga

DBGET integrated database retrieval system