KEGG   Escherichia coli O9 HS (commensal): EcHS_A0300
Entry
EcHS_A0300        CDS       T00591                                 

Gene name
rusA
Definition
(GenBank) crossover junction endodeoxyribonuclease RusA
  KO
K01160  crossover junction endodeoxyribonuclease RusA [EC:3.1.22.4]
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecx03400]
    EcHS_A0300 (rusA)
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     EcHS_A0300 (rusA)
DNA repair and recombination proteins [BR:ecx03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EcHS_A0300 (rusA)
SSDB
Motif
Pfam: RusA
Other DBs
NCBI-ProteinID: ABV04689
Position
307182..307544
AA seq 120 aa
MNEYQFVLPYPPSVNTYWRRRGSQYYISAKGQKYRKDVQQIIRQLKLDIFTKSRLRIKVI
ADVPDSRRRDLDNILKGLLDSLIHAGFAEDDEQFDDIRVIRGVKVPGGRLGIKITELENA
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaacgaatatcagtttgtgcttccatacccgccgtcggtgaacacctactggcgaaga
cggggaagccaatactacatcagcgctaaaggccagaaataccgaaaagatgtacagcaa
ataatccgccaactcaagttagacattttcaccaaatcaagactccgcatcaaagtcatc
gcagacgttccagactcccgccgccgcgacctcgacaacatcctgaaaggtttactcgac
tcccttatccacgccggatttgcggaagacgacgagcaattcgatgacattcgcgtaatt
cgtggcgtgaaagtaccaggcggaaggcttggaataaaaatcaccgaactggagaacgca
tga

DBGET integrated database retrieval system