KEGG   Escherichia coli O9 HS (commensal): EcHS_A0301
Entry
EcHS_A0301        CDS       T00591                                 

Definition
(GenBank) phage NinH protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Phage_NinH HTH_8 YdaS_antitoxin Cupin_7
Other DBs
NCBI-ProteinID: ABV04690
Position
307541..307729
AA seq 62 aa
MNATIQTIPELLIQTRGNQTEVARMLSCARGTVLKYNRDSKGERHVIVNGVLMVKQGKRG
RP
NT seq 189 nt   +upstreamnt  +downstreamnt
atgaacgccacaattcaaacgataccagagcttcttatccagacacgaggcaatcagacc
gaagtggcgaggatgctttcctgcgcaagaggaacagtgctcaagtacaaccgagacagc
aaaggcgagcgtcacgtaatagttaacggcgtcctgatggtcaaacagggcaaaagggga
aggccatga

DBGET integrated database retrieval system