KEGG   Escherichia coli O9 HS (commensal): EcHS_A0302
Entry
EcHS_A0302        CDS       T00591                                 

Definition
(GenBank) antitermination protein Q
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Antiterm DnaJ_CXXCXGXG RNHCP Cytochrome_C7
Other DBs
NCBI-ProteinID: ABV04691
Position
307726..308349
AA seq 207 aa
MRLESVAKFHSPKSPMMSDSPRATASDSLSGTDVMAAMGMAQSQAGFGMAAFCGKHELSQ
NDKQKAINYLMQFAHKVSGKYRGVAKLEGNTKAKVLQVLATFAYADYCRSAATPGARCRD
CHGTGRAVDIAKTEQWGRVVEKECGRCKGVGYSRMPASAAYRAVTMLIPNLTQPTWSRTV
KPLYDALVVQCHKEESIADNILNAVTR
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagactcgaaagcgtagctaaatttcattcgccaaaaagcccgatgatgagcgactca
ccacgggctacggcttctgactctctttccggtactgatgtgatggctgctatggggatg
gcgcaatcacaagccggattcggaatggctgcattctgcggtaagcatgaactcagccag
aacgacaaacaaaaggctatcaactatctgatgcaatttgcacacaaggtatcggggaaa
taccgtggtgtggcaaagctcgaaggaaatactaaggcaaaggtgctgcaagtgctcgca
acattcgcttatgcggattattgccgtagtgccgcgacgccgggcgcaagatgcagagat
tgtcacggtacaggccgtgcggttgatatagcaaaaacagagcagtgggggagagttgtt
gagaaagagtgcggaagatgcaaaggcgtcggctattcaaggatgccagcaagcgccgca
tatcgcgctgtaacgatgctaatcccaaatcttactcaacccacctggtcacgcactgtt
aagccgctgtatgacgctctggtggtgcaatgccacaaagaagagtcaatcgcagacaac
attttgaatgcggtcacacgttag

DBGET integrated database retrieval system