KEGG   Escherichia coli O9 HS (commensal): EcHS_A0303
Entry
EcHS_A0303        CDS       T00591                                 

Definition
(GenBank) phage holin, lambda family
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Phage_holin_3_1
Other DBs
NCBI-ProteinID: ABV04692
Position
309172..309495
AA seq 107 aa
MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYNGGAFTKTVIDATMCAIIAWFIRD
LLDFAGLSSNLAYITSVFIGYIGTDSIGSLIKRFAAKKAGVEDGGNQ
NT seq 324 nt   +upstreamnt  +downstreamnt
atgaagatgccagaaaaacatgacctgttagccgccattctcgcggcaaaggaacaaggc
atcggggcaatccttgcgtttgcaatggcgtaccttcgcggcagatataatggcggtgcg
tttacaaaaacagtaatcgacgcaacgatgtgcgccattatcgcctggttcattcgtgac
cttctcgacttcgccgggctaagtagcaatctcgcttatataacgagcgtgtttatcggc
tacatcggtactgactcgattggttcgcttatcaaacgcttcgctgctaaaaaagccgga
gtagaagatggtggaaatcaataa

DBGET integrated database retrieval system