KEGG   Escherichia coli O9 HS (commensal): EcHS_A0304
Entry
EcHS_A0304        CDS       T00591                                 

Definition
(GenBank) phage lysozyme
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Phage_lysozyme
Other DBs
NCBI-ProteinID: ABV04693
Position
309479..309955
AA seq 158 aa
MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLK
STAAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDIRQAIDRC
SNIWASLPGAGYGQFEHKVDSLIAKFKEAGGTVREIEV
NT seq 477 nt   +upstreamnt  +downstreamnt
atggtggaaatcaataatcaacgtaaggcgttcctcgatatgctggcgtggtcagaggga
actgataacggacgtcagaaaaccaggaatcatggttatgacgtcattgttggcggagag
ctattcactgattactccgatcaccctcgcaaacttgtcacgctaaaccccaaactcaaa
tcaacagcagccgggcgttaccagcttctttcccgttggtgggatgcctatcgtaagcag
cttggcctgaaagacttctctcccaaaagccaggacgctgtggcattgcagcagattaag
gagcgtggcgctttgccgatgattgatcgcggtgatatccgtcaggctatcgaccgttgc
agcaatatctgggcttcactgccgggcgctggttatggtcagttcgagcataaagttgac
agcctgattgcaaaattcaaagaggctggcggaacggtcagagagattgaggtatga

DBGET integrated database retrieval system