KEGG   Escherichia coli O9 HS (commensal): EcHS_A0305
Entry
EcHS_A0305        CDS       T00591                                 

Definition
(GenBank) bacteriophage lysis protein
  KO
K14744  prophage endopeptidase [EC:3.4.-.-]
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EcHS_A0305
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     EcHS_A0305
SSDB
Motif
Pfam: Phage_lysis Oleosin DUF4407 DUF3450 DUF1640 DUF3810 TPR_MLP1_2
Other DBs
NCBI-ProteinID: ABV04694
Position
309952..310389
AA seq 145 aa
MSRLTAIISALIICIIVCLSWAVNHYRDNAIAYKDQRDKATSIIADMQKRQRDVAELDAR
YTKELADANATIESLRADVSAGRKRLQVAATCAKSTTGASSMGDGESPRLTADAELNYYR
LRSGIDRITAQVNYLQEYIRTQCLK
NT seq 438 nt   +upstreamnt  +downstreamnt
atgagcagattaaccgcgattatctccgctctgattatctgcatcatcgtctgtctgtca
tgggctgttaatcattaccgtgataacgccatcgcctacaaagaccagcgcgataaagcc
acatccatcatcgctgatatgcagaagcgtcaacgtgatgtagcagaactcgacgcaaga
tatacaaaggaacttgctgatgctaacgcgactatcgaaagtctccgtgctgatgtttct
gctgggcgtaagcgcctgcaagtcgccgccacctgtgcaaagtcaacgaccggagccagc
agcatgggcgatggagaaagcccaagacttacagcagatgctgaactcaattattaccgt
ctccgaagtggaatcgacaggataaccgcgcaggttaactacctgcaggaatacatcagg
acgcaatgcctgaaataa

DBGET integrated database retrieval system