KEGG   Escherichia coli O9 HS (commensal): EcHS_A0306
Entry
EcHS_A0306        CDS       T00591                                 

Definition
(GenBank) putative phage regulatory protein, rha family
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Phage_pRha ORF11CD3 DUF3399 Baculo_gp64 MBF1
Other DBs
NCBI-ProteinID: ABV04695
Position
310553..311107
AA seq 184 aa
MRQAHFLKGKDAMNHQLANLDFRDMVVVSGDRVITTSRKVAAYFDKQHHHIIQKIEKLDC
SDEFLTSNFSRVTYEHKGNQYVEYEISKDGAMYIIMSFTGKKAAAIKEAFIKAFNWMRDR
LMELAHSYQREHNELMLEFMKEKDVASMSGRLLSRWGRIKKPQLIARIERLEQQAQISIP
GLPK
NT seq 555 nt   +upstreamnt  +downstreamnt
gtgagacaggctcactttctaaaaggtaaagacgctatgaatcatcaattggctaatctc
gatttccgggacatggtggttgtttctggtgatcgcgtgatcacaacctcccgcaaggta
gcagcttacttcgacaagcagcatcaccacatcattcagaaaatcgaaaagctagactgt
tcggatgaatttctaaccagcaacttttcgcgggttacctatgaacacaagggtaatcag
tatgttgaatatgaaatttccaaagacggcgcgatgtacatcatcatgtcgtttaccggc
aaaaaagctgccgccatcaaagaggcgtttatcaaagcatttaattggatgcgtgacagg
ctgatggagttggctcactcataccaaagagagcacaacgagttaatgctggagttcatg
aaggaaaaggatgttgccagtatgtcaggacgcttgctgagccgctggggcaggatcaaa
aaaccgcaactcatagcaagaatcgaaaggcttgagcagcaggcgcaaatatcgatcccc
ggactgccaaagtga

DBGET integrated database retrieval system