KEGG   Escherichia coli O9 HS (commensal): EcHS_A0307
Entry
EcHS_A0307        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: DUF2560 DUF2151
Other DBs
NCBI-ProteinID: ABV04696
Position
311462..311704
AA seq 80 aa
MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELFKIHFQSGGANSDITT
RTIEAVRKSKEALDLFTTGA
NT seq 243 nt   +upstreamnt  +downstreamnt
atggcagagattattcccatgactgaagaacagaaattccagttagagatttacaaactg
gtcatgaaccagaacgcagccgcagaagaagcatttcagttcattggcactgacgagctg
aagcttgagctattcaaaattcacttccagtcaggtggcgctaattcagatatcacgacc
cgcactatcgaagcggtgcgtaaatcgaaggaagcgttagacctgttcactaccggagca
taa

DBGET integrated database retrieval system