KEGG   Escherichia coli O9 HS (commensal): EcHS_A0308
Entry
EcHS_A0308        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: HTH_23 Terminase_5 GP3_package HTH_3 Phage_terminase HTH_29 HTH_7
Other DBs
NCBI-ProteinID: ABV04697
Position
311707..312147
AA seq 146 aa
MARPTKYQEAYAEQARKLCLLGYTDAELADFFEVSESTINKWKLDYPEFSESIKKGKAVA
DAEVSDRLYQRAMGFVAPDIDIRVIENRIVETPLEKYYPPDTTAAIFWLKNRQKDKWRDK
VDHELTGKDGGAIQIETSPMSTLFGK
NT seq 441 nt   +upstreamnt  +downstreamnt
atggcgcgcccaacaaagtatcaagaggcgtatgccgaacaggcacgcaaactgtgcttg
ctgggctacaccgatgcagagcttgctgatttcttcgaagtcagtgagtcaactattaac
aagtggaagcttgattatcctgagttttcggagtccataaaaaagggtaaggccgtcgct
gatgcagaagttagtgaccgtctttatcaacgcgctatgggcttcgtggctccagacatc
gatattcgtgttattgaaaacagaattgtcgaaactccgcttgagaagtattacccgcct
gatacaaccgccgccatcttctggcttaagaaccgacagaaggataaatggcgcgacaag
gttgatcacgagctaacaggcaaagacggcggcgcaatccagattgaaacatcaccgatg
agcactctattcggaaaatga

DBGET integrated database retrieval system