KEGG   Escherichia coli O9 HS (commensal): EcHS_A0309
Entry
EcHS_A0309        CDS       T00591                                 

Definition
(GenBank) phage terminase, large subunit, pbsx family
  KO
K06909  phage terminase large subunit
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    EcHS_A0309
SSDB
Motif
Pfam: Terminase_3 Terminase_3C Terminase_6 Helicase_RecD AAA_30
Other DBs
NCBI-ProteinID: ABV04698
Position
312144..313559
AA seq 471 aa
MTSINPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDS
VIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEA
EAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHF
PEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVV
SAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINDGADWATSLAIEDGADHYLWDGDGV
GAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAGAWADEVVQGDNVRTIGDVFRNK
RAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNN
GKLELMTKVEMKQKLGIPSPNLADALMMCMHCPESAAQPDYSSYSIPCGVG
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgacctcgattaatcctatctttgaaccgttcattgaggcgcatcgctacaaagtcgcc
aaaggcggtcgaggtagcggtaagtcatgggcaattgcgaggctgcttgttgaagcggcg
cgtcggcagccagtgcgtattctttgcgctcgtgaactgcaaaacagtatcagcgattcg
gtaatccggttgcttgaagataccatcgagcgtgaagggtattcggctgagtttgaaatt
cagcgttccatgattcgtcatctcggaacgaatgctgaattcatgttctacggcatcaaa
aacaacccgacgaagattaaatcgctcgaaggcattgatatctgctgggtggaagaagcg
gaagcggtaacgaaggaatcatgggatatcctgataccaaccatccgtaagccgttctct
gaaatatgggtgagctttaacccgaagaacatactcgacgatacctatcagcgattcgtt
gtaaatcctcccgatgatatttgcctgctgacggtgaactacaccgacaacccgcacttt
cctgaagttctccgtctggagatggaagagtgtaaacgcagaaacccgacactgtatcgt
cacatctggcttggtgagccagtaagcgcaagtgatatggcaatcatcaaacgtgaatgg
cttgaagccgcaaccgatgcgcacaagaaactcggatggaaagcgaaaggcgctgttgtc
tctgcacatgatccatcagatacagggccagatgctaaaggttacgcatcgcgccacggt
tcggtagttaagcgcattgccgaaggtctgctgatggacatcaacgatggtgctgactgg
gctacttcgctggcgattgaagacggcgctgaccactacctgtgggatggtgatggtgtt
ggtgccgggctacgcagacagacaacggaagcgttctccggcaagaaaatcaccgccacg
atgttcaagggcagcgaatcgccattcgatgaagatgcaccgtatcaggccggagcatgg
gccgatgaagtcgtacagggcgacaacgttcgcactattggcgatgtattccgcaataag
cgagcgcaattctattacgcgctggctgacaggctgtatctgacatatcgggcggttgtt
catggtgagtatgcagaccccgacgacatgctgagtttcgacaaagaagcgataggcgag
aagatgctggagaagctgtttgcagaactgacgcagattcagcgcaaattcaataacaac
gggaagctggagctaatgactaaggtcgaaatgaagcagaagctcggtattccatctcct
aacctggctgatgcgctgatgatgtgtatgcattgcccggagtcggctgcgcaacccgac
tattccagttactcaattccttgtggtgtaggttga

DBGET integrated database retrieval system